Product Browser

Last updated: 2014/4/21

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

EDA (Human) Recombinant ProteinHuPro Protein

  • Catalog # : H00001896-H02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified EDA (NP_001005609.1 245 a.a. - 389 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293T cells
  • Sequence:
  • ENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 21.23
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-EDA plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • > 10 ug/ml
  • Activity:
  • Not Tested
  • Quality Control Testing:
  • SDS-PAGE and Western Blot
    SDS-PAGE Gel
    QC Testing of H00001896-H02

    Western Blot
    QC Testing of H00001896-H02
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Entrez GeneID:
  • 1896
  • Gene Name:
  • EDA
  • Gene Alias:
  • ED1,ED1-A1,ED1-A2,EDA1,EDA2,HED,XHED,XLHED
  • Gene Description:
  • ectodysplasin A
  • Gene Summary:
  • The protein encoded by this gene is a type II membrane protein that can be cleaved by furin to produce a secreted form. The encoded protein, which belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling during the development of ectodermal organs. Defects in this gene are a cause of ectodermal dysplasia, anhidrotic, which is also known as X-linked hypohidrotic ectodermal dysplasia. Several transcript variants encoding many different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000023461,OTTHUMP00000023463,X-linked anhidroitic ectodermal dysplasia protein,ectodermal dysplasia 1, anhidrotic,ectodermal dysplasia, anhidrotic (hypohydrotic),ectodysplasin-A
  • RSS
  • YouTube
  • Linkedin
  • Facebook