EBF1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human EBF1 protein.
Immunogen
EBF1 (AAH41178.1, 1 a.a. ~ 560 a.a) full-length human protein.
Sequence
MFGIQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQLPALANTSVHAGMMGVNSFSGQLAVNVSEASQATNQGFTRNSSSVSPHGYVPSTTPQQTNYNSVTTSMNGYGSAAMSNLGGSPTFLNGSAANSPYAIVPSSPTMASSTSLPSNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNSLQAISGMIVPPM
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of EBF1 expression in transfected 293T cell line (H00001879-T01) by EBF1 MaxPab polyclonal antibody.
Lane 1: EBF1 transfected lysate(61.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — EBF1
Entrez GeneID
1879GeneBank Accession#
BC041178.1Protein Accession#
AAH41178.1Gene Name
EBF1
Gene Alias
COE1, EBF, FLJ39389, FLJ41763, O/E-1, OLF1
Gene Description
early B-cell factor 1
Omim ID
164343Gene Ontology
HyperlinkGene Summary
Olf and EBF transcription factor 1|early B-cell factor|olfactory neuronal transcription factor 1
Other Designations
Collier, Olf and EBF transcription factor 1|early B-cell factor|olfactory neuronal transcription factor 1
-
Interactome
-
Disease
-
Publication Reference
-
A global DNA methylation and gene expression analysis of early human B-cell development reveals a demethylation signature and transcription factor network.
Lee ST, Xiao Y, Muench MO, Xiao J, Fomin ME, Wiencke JK, Zheng S, Dou X, de Smith A, Chokkalingam A, Buffler P, Ma X, Wiemels JL.
Nucleic Acids Research 2012 Dec; 40(22):11339.
Application:ChIP, Human, Human fetal B-cells.
-
A global DNA methylation and gene expression analysis of early human B-cell development reveals a demethylation signature and transcription factor network.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com