Product Browser

Last updated: 2014/8/25
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DNASE2 polyclonal antibody (A01)

  • Catalog # : H00001777-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant DNASE2.
  • Immunogen:
  • DNASE2 (NP_001366, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GILPSNCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGMARKPSRAYKI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001777-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • DNASE2 polyclonal antibody (A01), Lot # 051024JC01 Western Blot analysis of DNASE2 expression in MES-SA/Dx5 ( Cat # L021V1 ).
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1777
  • Gene Name:
  • DNASE2
  • Gene Alias:
  • DNASE2A,DNL,DNL2
  • Gene Description:
  • deoxyribonuclease II, lysosomal
  • Gene Summary:
  • This gene encodes a member of the DNase family. The protein, located in the lysosome, hydrolyzes DNA under acidic conditions and mediates the breakdown of DNA during erythropoiesis and apoptosis. Two codominant alleles have been characterized, DNASE2*L (low activity) and DNASE2*H (high activity), that differ at one nucleotide in the promoter region. The DNASE2*H allele is represented in this record. [provided by RefSeq
  • Other Designations:
  • DNase II alpha,DNase II, lysosomal,R31240_2,acid DNase
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook