Product Browser

Last updated: 2014/10/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DDIT3 purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00001649-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human DDIT3 protein.
  • Immunogen:
  • DDIT3 (AAH03637.1, 1 a.a. ~ 169 a.a) full-length human protein.
  • Sequence:
  • MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of DDIT3 expression in transfected 293T cell line (H00001649-T03) by DDIT3 MaxPab polyclonal antibody.

    Lane 1: DDIT3 transfected lysate(19.20 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 1649
  • Gene Name:
  • DDIT3
  • Gene Alias:
  • CEBPZ,CHOP,CHOP10,GADD153,MGC4154
  • Gene Description:
  • DNA-damage-inducible transcript 3
  • Other Designations:
  • C/EBP homologous protein,C/EBP zeta,CCAAT/enhancer-binding protein homologous protein,growth arrest- and DNA damage-inducible
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook