Product Browser

Last updated: 2014/10/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GADD45A (Human) Recombinant Protein (Q01)

  • Catalog # : H00001647-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GADD45A partial ORF ( AAH11757, 76 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.53
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001647-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1647
  • Gene Name:
  • GADD45A
  • Gene Alias:
  • DDIT1,GADD45
  • Gene Description:
  • growth arrest and DNA-damage-inducible, alpha
  • Gene Summary:
  • This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. [provided by RefSeq
  • Other Designations:
  • DNA damage-inducible transcript 1,DNA damage-inducible transcript-1,DNA-damage-inducible transcript 1,OTTHUMP00000010979,growth arrest and DNA-damage-inducible 45 alpha
  • RSS
  • YouTube
  • Linkedin
  • Facebook