Product Browser
 
  • Related Product Showcase
  • By Research Area
  • By Pathway
  • By Biomarker
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

GADD45A polyclonal antibody (A01)   

  • Catalog # : H00001647-A01
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 50 uL
  • USD $ 229
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant GADD45A.
  • Immunogen:
  • GADD45A (AAH11757, 76 a.a. ~ 165 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1647
  • Gene Name:
  • GADD45A
  • Gene Alias:
  • DDIT1,GADD45
  • Gene Description:
  • growth arrest and DNA-damage-inducible, alpha
  • Gene Summary:
  • This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. [provided by RefSeq
  • Other Designations:
  • DNA damage-inducible transcript 1,DNA damage-inducible transcript-1,DNA-damage-inducible transcript 1,OTTHUMP00000010979,growth arrest and DNA-damage-inducible 45 alpha
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!