AKR1C1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human AKR1C1 protein.
Immunogen
AKR1C1 (NP_001344.2, 1 a.a. ~ 323 a.a) full-length human protein.
Sequence
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (73); Rat (70)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
AKR1C1 MaxPab polyclonal antibody. Western Blot analysis of AKR1C1 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of AKR1C1 expression in transfected 293T cell line (H00001645-T01) by AKR1C1 MaxPab polyclonal antibody.
Lane 1: AKR1C1 transfected lysate(35.53 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — AKR1C1
Entrez GeneID
1645GeneBank Accession#
NM_001353.5Protein Accession#
NP_001344.2Gene Name
AKR1C1
Gene Alias
2-ALPHA-HSD, 20-ALPHA-HSD, C9, DD1, DDH, DDH1, H-37, HAKRC, MBAB, MGC8954
Gene Description
aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase)
Omim ID
600449Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq
Other Designations
20 alpha-hydroxysteroid dehydrogenase|OTTHUMP00000018992|aldo-keto reductase C|aldo-keto reductase family 1, member C1|chlordecone reductase homolog|dihydrodiol dehydrogenase 1|dihydrodiol dehydrogenase isoform DD1|hepatic dihydrodiol dehydrogenase|trans-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
High Levels of Hyaluronic Acid Synthase-2 Mediate NRF2-Driven Chemoresistance in Breast Cancer Cells.
Bo-Hyun Choi, Ingeun Ryoo, Kyeong Hwa Sim, Hyeon-Jin Ahn, Youn Ju Lee, Mi-Kyoung Kwak.
Biomolecules & Therapeutics 2022 Jul; 30(4):368.
Application:WB, Human, MCF7, SNU620 cells.
-
High NRF2 level mediates cancer stem cell-like properties of aldehyde dehydrogenase (ALDH)-high ovarian cancer cells: inhibitory role of all-trans retinoic acid in ALDH/NRF2 signaling.
Kim D, Choi BH, Ryoo IG, Kwak MK.
Cell Death & Disease 2018 Aug; 9(9):896.
Application:WB, Human, ALDH-H cells.
-
NFE2L2/NRF2 silencing-inducible miR-206 targets c-MET/EGFR and suppresses BCRP/ABCG2 in cancer cells.
Choi BH, Ryu DY, Ryoo IG, Kwak MK.
Oncotarget 2017 Nov; 8(63):107188.
Application:WB-Ce, Human, SKOV3 cells.
-
The Sensitivity of Cancer Cells to Pheophorbide a-Based Photodynamic Therapy Is Enhanced by NRF2 Silencing.
Choi BH, Ryoo IG, Kang HC, Kwak MK.
PLoS One 2014 Sep; 9(9):e107158.
Application:WB-Tr, Human, MDA-MB-231 cells.
-
An endogenous inhibitor of angiogenesis inversely correlates with side population phenotype and function in human lung cancer cells.
Han H, Bourboulia D, Jensen-Taubman S, Isaac B, Wei B, Stetler-Stevenson WG.
Oncogene 2014 Feb; 33(9):1198.
Application:WB-Ce, Human, A-549 cells.
-
Proteasome inhibitors MG-132 and bortezomib induce AKR1C1; AKR1C3; AKR1B1; and AKR1B10 in human colon cancer cell lines SW-480 and HT-29.
Ebert B, Kisiela M, Wsol V, Maser E.
Chemico-biological Interactions 2011 May; 191(1-3):239.
Application:WB, Human, Caco-2, HT-29, HCT116, SW-480, A-549, PANC-1, A431, HepG2 cells.
-
High Levels of Hyaluronic Acid Synthase-2 Mediate NRF2-Driven Chemoresistance in Breast Cancer Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com