DCK monoclonal antibody (M02), clone 1E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DCK.
Immunogen
DCK (NP_000779, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DCK is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — DCK
Entrez GeneID
1633GeneBank Accession#
NM_000788Protein Accession#
NP_000779Gene Name
DCK
Gene Alias
MGC117410, MGC138632
Gene Description
deoxycytidine kinase
Omim ID
125450Gene Ontology
HyperlinkGene Summary
Deoxycytidine kinase (DCK) is required for the phosphorylation of several deoxyribonucleosides and their nucleoside analogs. Deficiency of DCK is associated with resistance to antiviral and anticancer chemotherapeutic agents. Conversely, increased deoxycytidine kinase activity is associated with increased activation of these compounds to cytotoxic nucleoside triphosphate derivatives. DCK is clinically important because of its relationship to drug resistance and sensitivity. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
- Acute Disease
- Adenocarcinoma
- Breast cancer
- Breast Neoplasms
- Carcinoma
- Kidney Failure
- Leukemia
- Neoplasms
- Neutropenia
+ View More Disease
-
Publication Reference
-
Laser microdissection and primary cell cultures improve pharmacogenetic analysis in pancreatic adenocarcinoma.
Funel N, Giovannetti E, Del Chiaro M, Mey V, Pollina LE, Nannizzi S, Boggi U, Ricciardi S, Del Tacca M, Bevilacqua G, Mosca F, Danesi R, Campani D.
Laboratory Investigation; a Journal of Technical Methods and Pathology 2008 May; 88(7):773.
Application:WB, Human, Primary cell cultures from patients with pancreatic ductal adenocarcinoma (PDAC).
-
Laser microdissection and primary cell cultures improve pharmacogenetic analysis in pancreatic adenocarcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com