DBT purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
DBT MaxPab polyclonal antibody. Western Blot analysis of DBT expression in human liver.
Western Blot (Cell lysate)
DBT MaxPab polyclonal antibody. Western Blot analysis of DBT expression in A-431.
Western Blot (Transfected lysate)
Western Blot analysis of DBT expression in transfected 293T cell line (H00001629-T01) by DBT MaxPab polyclonal antibody.
Lane 1: DBT transfected lysate(53.02 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human DBT protein.
Immunogen
DBT (AAH16675.1, 1 a.a. ~ 482 a.a) full-length human protein.
Sequence
MAAVRMLRTWSRNAGKLICVRYFQTCGNVHVLKPNYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVGQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (88)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
DBT MaxPab polyclonal antibody. Western Blot analysis of DBT expression in human liver.Western Blot (Cell lysate)
DBT MaxPab polyclonal antibody. Western Blot analysis of DBT expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of DBT expression in transfected 293T cell line (H00001629-T01) by DBT MaxPab polyclonal antibody.
Lane 1: DBT transfected lysate(53.02 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — DBT
Entrez GeneID
1629GeneBank Accession#
BC016675.1Protein Accession#
AAH16675.1Gene Name
DBT
Gene Alias
BCATE2, E2, E2B, MGC9061
Gene Description
dihydrolipoamide branched chain transacylase E2
Gene Ontology
HyperlinkGene Summary
The branched-chain alpha-keto acid dehydrogenase complex (BCKD) is an inner-mitochondrial enzyme complex involved in the breakdown of the branched-chain amino acids isoleucine, leucine, and valine. The BCKD complex is thought to be composed of a core of 24 transacylase (E2) subunits, and associated decarboxylase (E1), dehydrogenase (E3), and regulatory subunits. This gene encodes the transacylase (E2) subunit. Mutations in this gene result in maple syrup urine disease, type 2. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
Other Designations
BCKAD E2 subunit|E2 component of branched chain alpha-keto acid dehydrogenase complex|OTTHUMP00000012596|branched chain acyltransferase, E2 component|dihydrolipoamide branched chain transacylase|dihydrolipoyl transacylase|dihydrolipoyllysine-residue (2-me
-
Interactome
-
Pathway
-
Publication Reference
-
Amino Acid starvation has opposite effects on mitochondrial and cytosolic protein synthesis.
Johnson MA, Vidoni S, Durigon R, Pearce SF, Rorbach J, He J, Brea-Calvo G, Minczuk M, Reyes A, Holt IJ, Spinazzola A.
PLoS One 2014 Apr; 9(4):e93597.
Application：WB-Ce, Human, HEK293T Cells.
-
Amino Acid starvation has opposite effects on mitochondrial and cytosolic protein synthesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com