Product Browser

Last updated: 2014/9/1

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CYP3A4 (Human) Recombinant Protein (Q01)

  • Catalog # : H00001576-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CYP3A4 partial ORF ( NP_000097.2, 404 a.a. - 503 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • DPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001576-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1576
  • Gene Name:
  • CYP3A4
  • Gene Alias:
  • CP33,CP34,CYP3A,CYP3A3,HLP,MGC126680,NF-25,P450C3,P450PCN1
  • Gene Description:
  • cytochrome P450, family 3, subfamily A, polypeptide 4
  • Gene Summary:
  • This gene, CYP3A4, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. This enzyme is involved in the metabolism of approximately half the drugs which are are used today, including acetaminophen, codeine, cyclosporin A, diazepam and erythromycin. The enzyme also metabolizes some steroids and carcinogens. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Previously another CYP3A gene, CYP3A3, was thought to exist; however, it is now thought that this sequence represents a transcript variant of CYP3A4. [provided by RefSeq
  • Other Designations:
  • P450-III, steroid inducible,cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 3,cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4,cytochrome P450, subfamily IIIA, polypeptide 4,glucocorticoid-inducible P450,nifedipine o
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook