CTSZ purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CTSZ MaxPab polyclonal antibody. Western Blot analysis of CTSZ expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of CTSZ expression in transfected 293T cell line (H00001522-T02) by CTSZ MaxPab polyclonal antibody.
Lane 1: CTSZ transfected lysate(33.33 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CTSZ protein.
Immunogen
CTSZ (NP_001327.2, 1 a.a. ~ 303 a.a) full-length human protein.
Sequence
MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (87)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CTSZ MaxPab polyclonal antibody. Western Blot analysis of CTSZ expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of CTSZ expression in transfected 293T cell line (H00001522-T02) by CTSZ MaxPab polyclonal antibody.
Lane 1: CTSZ transfected lysate(33.33 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CTSZ
Entrez GeneID
1522GeneBank Accession#
NM_001336.2Protein Accession#
NP_001327.2Gene Name
CTSZ
Gene Alias
CTSX, FLJ17088
Gene Description
cathepsin Z
Omim ID
603169Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. This gene is expressed ubiquitously in cancer cell lines and primary tumors and, like other members of this family, may be involved in tumorigenesis. [provided by RefSeq
Other Designations
OTTHUMP00000031409|cathepsin X|preprocathepsin P
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com