CTSB purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CTSB MaxPab polyclonal antibody. Western Blot analysis of CTSB expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of CTSB expression in transfected 293T cell line (H00001508-T01) by CTSB MaxPab polyclonal antibody.
Lane 1: CTSB transfected lysate(37.29 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CTSB protein.
Immunogen
CTSB (NP_001899.1, 1 a.a. ~ 339 a.a) full-length human protein.
Sequence
MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CTSB MaxPab polyclonal antibody. Western Blot analysis of CTSB expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of CTSB expression in transfected 293T cell line (H00001508-T01) by CTSB MaxPab polyclonal antibody.
Lane 1: CTSB transfected lysate(37.29 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CTSB
Entrez GeneID
1508GeneBank Accession#
NM_001908.3Protein Accession#
NP_001899.1Gene Name
CTSB
Gene Alias
APPS, CPSB
Gene Description
cathepsin B
Omim ID
116810Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a lysosomal cysteine proteinase composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. It is also known as amyloid precursor protein secretase and is involved in the proteolytic processing of amyloid precursor protein (APP). Incomplete proteolytic processing of APP has been suggested to be a causative factor in Alzheimer disease, the most common cause of dementia. Overexpression of the encoded protein, which is a member of the peptidase C1 family, has been associated with esophageal adenocarcinoma and other tumors. At least five transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
APP secretase|OTTHUMP00000116009|amyloid precursor protein secretase|cathepsin B1|cysteine protease|preprocathepsin B
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com