MAPK14 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human MAPK14 protein.
Immunogen
MAPK14 (NP_620581.1, 1 a.a. ~ 360 a.a) full-length human protein.
Sequence
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MAPK14 MaxPab rabbit polyclonal antibody. Western Blot analysis of MAPK14 expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of MAPK14 expression in transfected 293T cell line (H00001432-T02) by MAPK14 MaxPab polyclonal antibody.
Lane 1: MAPK14 transfected lysate(41.30 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MAPK14 and EGFR. HeLa cells were stained with anti-MAPK14 rabbit purified polyclonal 1:1200 and anti-EGFR mouse purified polyclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — MAPK14
Entrez GeneID
1432GeneBank Accession#
NM_139012Protein Accession#
NP_620581.1Gene Name
MAPK14
Gene Alias
CSBP1, CSBP2, CSPB1, EXIP, Mxi2, PRKM14, PRKM15, RK, SAPK2A, p38, p38ALPHA
Gene Description
mitogen-activated protein kinase 14
Omim ID
600289Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
Csaids binding protein|MAP kinase Mxi2|MAX-interacting protein 2|cytokine suppressive anti-inflammatory drug binding protein|p38 MAP kinase|p38 mitogen activated protein kinase|p38alpha Exip|stress-activated protein kinase 2A
-
Interactome
-
Pathway
- Amyotrophic lateral sclerosis (ALS)
- Epithelial cell signaling in Helicobacter pylori infection
- Fc epsilon RI signaling pathway
- GnRH signaling pathway
- Leukocyte transendothelial migration
- MAPK signaling pathway
- Neurotrophin signaling pathway
- T cell receptor signaling pathway
- Toll-like receptor signaling pathway
+ View More Disease
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com