Product Browser

Last updated: 2014/9/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CRK polyclonal antibody (A01)

  • Catalog # : H00001398-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CRK.
  • Immunogen:
  • CRK (AAH08506, 127 a.a. ~ 226 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • VILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001398-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1398
  • Gene Name:
  • CRK
  • Gene Alias:
  • CRKII
  • Gene Description:
  • v-crk sarcoma virus CT10 oncogene homolog (avian)
  • Gene Summary:
  • This gene encodes a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. The product of this gene has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. The N-terminal SH2 domain of this protein functions as a positive regulator of transformation whereas the C-terminal SH3 domain functions as a negative regulator of transformation. Two alternative transcripts encoding different isoforms with distinct biological activity have been described. [provided by RefSeq
  • Other Designations:
  • avian sarcoma virus CT10 (v-crk) oncogene homolog,v-crk avian sarcoma virus CT10 oncogene homolog,v-crk sarcoma virus CT10 oncogene homolog
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook