CREM (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CREM full-length ORF ( NP_001872.3, 1 a.a. - 137 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYSMYAAIRYDTVLALSLL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
41.3
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CREM
Entrez GeneID
1390GeneBank Accession#
NM_001881.2Protein Accession#
NP_001872.3Gene Name
CREM
Gene Alias
ICER, MGC111110, MGC17881, MGC41893, hCREM-2
Gene Description
cAMP responsive element modulator
Omim ID
123812Gene Ontology
HyperlinkGene Summary
This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. [provided by RefSeq
Other Designations
OTTHUMP00000019442|OTTHUMP00000019443|OTTHUMP00000019444|OTTHUMP00000019446|OTTHUMP00000019448|cAMP response element modulator|hCREM 2alpha-b protein|hCREM 2beta-a protein|inducible cAMP early repressor ICER
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com