Product Browser

Last updated: 2014/7/21
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CREM MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00001390-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CREM protein.
  • Immunogen:
  • CREM (NP_001872.3, 1 a.a. ~ 137 a.a) full-length human protein.
  • Sequence:
  • MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYSMYAAIRYDTVLALSLL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CREM expression in transfected 293T cell line (H00001390-T01) by CREM MaxPab polyclonal antibody.

    Lane 1: CREM transfected lysate(15.07 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 1390
  • Gene Name:
  • CREM
  • Gene Alias:
  • ICER,MGC111110,MGC17881,MGC41893,hCREM-2
  • Gene Description:
  • cAMP responsive element modulator
  • Gene Summary:
  • This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000019442,OTTHUMP00000019443,OTTHUMP00000019444,OTTHUMP00000019446,OTTHUMP00000019448,cAMP response element modulator,hCREM 2alpha-b protein,hCREM 2beta-a protein,inducible cAMP early repressor ICER
  • RSS
  • YouTube
  • Linkedin
  • Facebook