CNTFR polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CNTFR polyclonal antibody (A01), Lot # 060501JCS1 Western Blot analysis of CNTFR expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
CNTFR polyclonal antibody (A01), Lot # 060501JCS1. Western Blot analysis of CNTFR expression in A-431.
Western Blot detection against Immunogen (38.43 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant CNTFR.
Immunogen
CNTFR (NP_671693, 47 a.a. ~ 158 a.a) partial recombinant protein with GST tag.
Sequence
GTANWDAAVTWRVNGTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (94)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.43 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CNTFR polyclonal antibody (A01), Lot # 060501JCS1 Western Blot analysis of CNTFR expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
CNTFR polyclonal antibody (A01), Lot # 060501JCS1. Western Blot analysis of CNTFR expression in A-431.Western Blot (Recombinant protein)
ELISA
-
Gene Info — CNTFR
Entrez GeneID
1271GeneBank Accession#
NM_147164Protein Accession#
NP_671693Gene Name
CNTFR
Gene Alias
MGC1774
Gene Description
ciliary neurotrophic factor receptor
Omim ID
118946Gene Ontology
HyperlinkGene Summary
This gene encodes a hematopoeitin/interferon-class receptor belonging to the cytokine superfamily of receptors. The encoded gene product represents the CNTF-specific alpha subunit of a heterotrimer forming the CNTF receptor complex, which also includes LIFR and gp130. The receptor is attached to the membrane by a glycosyl-phosphatidylinositol linkage and contains an immunoglobulin-like C2-type domain and a fibronectin type-III domain. Signal transduction requires that CNTF bind first to this alpha component, which permits the recruitment of gp130 and LIFR beta to form the tripartite receptor complex. Signal transduction stimulates gene expression, cell survival or differentiation in a variety of neuronal cell types. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified. [provided by RefSeq
Other Designations
CNTFR alpha|OTTHUMP00000021270|OTTHUMP00000021271|ciliary neurotrophic factor receptor alpha
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com