CLTB monoclonal antibody (M01), clone 4B12-1E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CLTB monoclonal antibody (M01), clone 4B12-1E3 Western Blot analysis of CLTB expression in MCF-7 ( Cat # L046V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of CLTB expression in transfected 293T cell line by CLTB monoclonal antibody (M01), clone 4B12-1E3.
Lane 1: CLTB transfected lysate(23.2 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CLTB on formalin-fixed paraffin-embedded human transitional cell carcinoma tissue. [antibody concentration 2 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CLTB is 0.1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to CLTB on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (48.95 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CLTB.
Immunogen
CLTB (AAH06457, 1 a.a. ~ 211 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Host
Mouse
Reactivity
Human
Isotype
IgG2b kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (48.95 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CLTB monoclonal antibody (M01), clone 4B12-1E3 Western Blot analysis of CLTB expression in MCF-7 ( Cat # L046V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CLTB expression in transfected 293T cell line by CLTB monoclonal antibody (M01), clone 4B12-1E3.
Lane 1: CLTB transfected lysate(23.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CLTB on formalin-fixed paraffin-embedded human transitional cell carcinoma tissue. [antibody concentration 2 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CLTB is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CLTB on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CLTB
Entrez GeneID
1212GeneBank Accession#
BC006457Protein Accession#
AAH06457Gene Name
CLTB
Gene Alias
LCB
Gene Description
clathrin, light chain (Lcb)
Omim ID
118970Gene Ontology
HyperlinkGene Summary
Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
clathrin, light polypeptide|clathrin, light polypeptide (Lcb)
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
A conformational switch in clathrin light chain regulates lattice structure and endocytosis at the plasma membrane of mammalian cells.
Kazuki Obashi , Kem A Sochacki , Marie-Paule Strub , Justin W Taraska.
Nature Communications 2023 Feb; 14(1):732.
Application：WB-Ce, Human, HeLa cells.
-
Crosstalk between CLCb/Dyn1-Mediated Adaptive Clathrin-Mediated Endocytosis and Epidermal Growth Factor Receptor Signaling Increases Metastasis.
Chen PH, Bendris N, Hsiao YJ, Reis CR, Mettlen M, Chen HY, Yu SL, Schmid SL.
Developmental Cell 2017 Feb; 40(3):278.
Application：IHC-P, Human, Human lung cancer.
-
A conformational switch in clathrin light chain regulates lattice structure and endocytosis at the plasma membrane of mammalian cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com