CLTB MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CLTB MaxPab rabbit polyclonal antibody. Western Blot analysis of CLTB expression in mouse spleen.
Western Blot (Tissue lysate)
CLTB MaxPab rabbit polyclonal antibody. Western Blot analysis of CLTB expression in human stomach.
Western Blot (Transfected lysate)
Western Blot analysis of CLTB expression in transfected 293T cell line (H00001212-T03) by CLTB MaxPab polyclonal antibody.
Lane 1: CLTB transfected lysate(23.2 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of CLTB transfected lysate using anti-CLTB MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CLTB purified MaxPab mouse polyclonal antibody (B01P) (H00001212-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CLTB protein.
Immunogen
CLTB (NP_001825.1, 1 a.a. ~ 211 a.a) full-length human protein.
Sequence
MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CLTB MaxPab rabbit polyclonal antibody. Western Blot analysis of CLTB expression in mouse spleen.Western Blot (Tissue lysate)
CLTB MaxPab rabbit polyclonal antibody. Western Blot analysis of CLTB expression in human stomach.Western Blot (Transfected lysate)
Western Blot analysis of CLTB expression in transfected 293T cell line (H00001212-T03) by CLTB MaxPab polyclonal antibody.
Lane 1: CLTB transfected lysate(23.2 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of CLTB transfected lysate using anti-CLTB MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CLTB purified MaxPab mouse polyclonal antibody (B01P) (H00001212-B01P). -
Gene Info — CLTB
Entrez GeneID
1212GeneBank Accession#
NM_001834Protein Accession#
NP_001825.1Gene Name
CLTB
Gene Alias
LCB
Gene Description
clathrin, light chain (Lcb)
Omim ID
118970Gene Ontology
HyperlinkGene Summary
Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
clathrin, light polypeptide|clathrin, light polypeptide (Lcb)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com