- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16217)
- Monoclonal Ab (21396)
- Polyclonal Ab (27483)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9167)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
- Related Product Showcase
- By Research Area
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > MaxPab® Ab > Human > Binding > Others > CLTB MaxPab mouse polyclonal antibody (B01)
CLTB MaxPab mouse polyclonal antibody (B01) 
- Catalog # : H00001212-B01
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 50 uL
- USD $ 319
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Mouse polyclonal antibody raised against a full-length human CLTB protein.
- Immunogen:
- CLTB (NP_001825, 1 a.a. ~ 211 a.a) full-length human protein.
- Sequence:
- MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
- Host:
- Mouse
- Reactivity:
- Human
- Quality Control Testing:
- Antibody reactive against mammalian transfected lysate.
- Storage Buffer:
- No additive
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Note:
- For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
- MSDS:
Download
- Applications
- Western Blot (Tissue lysate)
- CLTB MaxPab polyclonal antibody. Western Blot analysis of CLTB expression in human liver.
- Protocol Download
- Western Blot (Transfected lysate)
- Western Blot analysis of CLTB expression in transfected 293T cell line (H00001212-T01) by CLTB MaxPab polyclonal antibody.
Lane 1: CLTB transfected lysate(23.21 KDa).
Lane 2: Non-transfected lysate. - Protocol Download
- Entrez GeneID:
- 1212
- GeneBank Accession#:
- NM_001834
- Protein Accession#:
- NP_001825
- Gene Name:
- CLTB
- Gene Alias:
- LCB
- Gene Description:
- clathrin, light chain (Lcb)
- Omim ID:
- 118970
- Gene Ontology:
- Hyperlink
- Gene Summary:
- Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. [provided by RefSeq
- Other Designations:
- clathrin, light polypeptide,clathrin, light polypeptide (Lcb)
- Gene Pathway
- Related Disease
