CLTA purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CLTA MaxPab rabbit polyclonal antibody. Western Blot analysis of CLTA expression in mouse kidney.
Western Blot (Cell lysate)
CLTA MaxPab rabbit polyclonal antibody. Western Blot analysis of CLTA expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of CLTA expression in transfected 293T cell line (H00001211-T02) by CLTA MaxPab polyclonal antibody.
Lane 1: CLTA transfected lysate(23.70 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CLTA protein.
Immunogen
CLTA (NP_001824.1, 1 a.a. ~ 218 a.a) full-length human protein.
Sequence
MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (87); Rat (86)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CLTA MaxPab rabbit polyclonal antibody. Western Blot analysis of CLTA expression in mouse kidney.Western Blot (Cell lysate)
CLTA MaxPab rabbit polyclonal antibody. Western Blot analysis of CLTA expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of CLTA expression in transfected 293T cell line (H00001211-T02) by CLTA MaxPab polyclonal antibody.
Lane 1: CLTA transfected lysate(23.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CLTA
Entrez GeneID
1211GeneBank Accession#
NM_001833.1Protein Accession#
NP_001824.1Gene Name
CLTA
Gene Alias
LCA
Gene Description
clathrin, light chain (Lca)
Omim ID
118960Gene Ontology
HyperlinkGene Summary
Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
OTTHUMP00000021365|OTTHUMP00000021366|clathrin, light polypeptide (Lca)|clathrin, light polypeptide A
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com