CLIC2 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CLIC2 MaxPab polyclonal antibody. Western Blot analysis of CLIC2 expression in human spleen.
Western Blot (Transfected lysate)
Western Blot analysis of CLIC2 expression in transfected 293T cell line (H00001193-T03) by CLIC2 MaxPab polyclonal antibody.
Lane 1: CLIC2 transfected lysate(27.17 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CLIC2 protein.
Immunogen
CLIC2 (NP_001280.3, 1 a.a. ~ 247 a.a) full-length human protein.
Sequence
MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (93)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CLIC2 MaxPab polyclonal antibody. Western Blot analysis of CLIC2 expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of CLIC2 expression in transfected 293T cell line (H00001193-T03) by CLIC2 MaxPab polyclonal antibody.
Lane 1: CLIC2 transfected lysate(27.17 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CLIC2
Entrez GeneID
1193GeneBank Accession#
NM_001289.4Protein Accession#
NP_001280.3Gene Name
CLIC2
Gene Alias
CLIC2b, XAP121
Gene Description
chloride intracellular channel 2
Omim ID
300138Gene Ontology
HyperlinkGene Summary
Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 2 is a member of the p64 family; the protein is detected in fetal liver and adult skeletal muscle tissue. This gene maps to the candidate region on chromosome X for incontinentia pigmenti. [provided by RefSeq
Other Designations
OTTHUMP00000024248
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com