Product Browser

Last updated: 2014/12/14
  • Related Product Showcase
  • By Research Area

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CLIC1 monoclonal antibody (M01A), clone 2D4

  • Catalog # : H00001192-M01A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant CLIC1.
  • Immunogen:
  • CLIC1 (AAH64527.1, 1 a.a. ~ 241 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001192-M01A
    Western Blot detection against Immunogen (52.25 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CLIC1 monoclonal antibody (M01A), clone 2D4 Western Blot analysis of CLIC1 expression in HL-60 ( Cat # L014V1 ).
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1192
  • Gene Name:
  • CLIC1
  • Gene Alias:
  • G6,NCC27
  • Gene Description:
  • chloride intracellular channel 1
  • Gene Summary:
  • Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000029131,OTTHUMP00000029133,OTTHUMP00000029137,OTTHUMP00000174486,RNCC protein,chloride channel ABP,nuclear chloride ion channel protein,p64CLCP
  • RSS
  • YouTube
  • Linkedin
  • Facebook