Product Browser
 
  • Related Product Showcase
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

CIDEA purified MaxPab mouse polyclonal antibody (B01P)   MaxPab

  • Catalog # : H00001149-B01P
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 50 ug
  • USD $ 319
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CIDEA protein.
  • Immunogen:
  • CIDEA (NP_938031.1, 1 a.a. ~ 253 a.a) full-length human protein.
  • Sequence:
  • MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CIDEA expression in transfected 293T cell line (H00001149-T01) by CIDEA MaxPab polyclonal antibody.

    Lane 1: CIDEA transfected lysate(27.83 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 1149
  • Gene Name:
  • CIDEA
  • Gene Alias:
  • CIDE-A
  • Gene Description:
  • cell death-inducing DFFA-like effector a
  • Gene Summary:
  • This gene encodes the homolog of the mouse protein Cidea that has been shown to activate apoptosis. This activation of apoptosis is inhibited by the DNA fragmentation factor DFF45 but not by caspase inhibitors. Mice that lack functional Cidea have higher metabolic rates, higher lipolysis in brown adipose tissue and higher core body temperatures when subjected to cold. These mice are also resistant to diet-induced obesity and diabetes. This suggests that in mice this gene product plays a role in thermogenesis and lipolysis. Two alternative transcripts encoding different isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • cell death activator
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!