CHD3 monoclonal antibody (M01), clone 5E12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CHD3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (35.42 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CHD3.
Immunogen
CHD3 (NP_001005273, 1654 a.a. ~ 1741 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KPLDGQEHRERPEGETGDLGKREDVKGDRELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIWH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.42 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CHD3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]ELISA
-
Gene Info — CHD3
Entrez GeneID
1107GeneBank Accession#
NM_001005273Protein Accession#
NP_001005273Gene Name
CHD3
Gene Alias
Mi-2a, Mi2-ALPHA, ZFH
Gene Description
chromodomain helicase DNA binding protein 3
Omim ID
602120Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the CHD family of proteins which are characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. This protein is one of the components of a histone deacetylase complex referred to as the Mi-2/NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Chromatin remodeling is essential for many processes including transcription. Autoantibodies against this protein are found in a subset of patients with dermatomyositis. Three alternatively spliced transcripts encoding different isoforms have been described. [provided by RefSeq
Other Designations
zinc-finger helicase (Snf2-like)
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com