Product Browser

Last updated: 2014/10/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CETN2 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00001069-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CETN2 protein.
  • Immunogen:
  • CETN2 (NP_004335.1, 1 a.a. ~ 172 a.a) full-length human protein.
  • Sequence:
  • MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CETN2 expression in transfected 293T cell line (H00001069-T01) by CETN2 MaxPab polyclonal antibody.

    Lane 1: CETN2 transfected lysate(18.92 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 1069
  • Gene Name:
  • CETN2
  • Gene Alias:
  • CALT,CEN2
  • Gene Description:
  • centrin, EF-hand protein, 2
  • Gene Summary:
  • Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome. The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000026058,caltractin,caltractin (20kD calcium-binding protein)
  • RSS
  • YouTube
  • Linkedin
  • Facebook