Product Browser

Last updated: 2014/7/7

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CEBPB (Human) Recombinant Protein (P01)

  • Catalog # : H00001051-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CEBPB full-length ORF ( AAH21931.1, 1 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 62.5
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001051-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1051
  • Gene Name:
  • CEBPB
  • Gene Alias:
  • C/EBP-beta,CRP2,IL6DBP,LAP,MGC32080,NF-IL6,TCF5
  • Gene Description:
  • CCAAT/enhancer binding protein (C/EBP), beta
  • Gene Summary:
  • The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related proteins CEBP-alpha, CEBP-delta, and CEBP-gamma. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses and has been shown to bind to the IL-1 response element in the IL-6 gene, as well as to regulatory regions of several acute-phase and cytokine genes. In addition, the encoded protein can bind the promoter and upstream element and stimulate the expression of the collagen type I gene. [provided by RefSeq
  • Other Designations:
  • CCAAT/enhancer binding protein beta,interleukin 6-dependent DNA-binding protein,liver-enriched transcriptional activator protein,nuclear factor of interleukin 6,transcription factor 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook