CEBPB purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CEBPB protein.
Immunogen
CEBPB (AAH21931.1, 1 a.a. ~ 345 a.a) full-length human protein.
Sequence
MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (66); Rat (66)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CEBPB expression in transfected 293T cell line (H00001051-T01) by CEBPB MaxPab polyclonal antibody.
Lane 1: CEBPB transfected lysate(37.95 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CEBPB
Entrez GeneID
1051GeneBank Accession#
NM_005194.2Protein Accession#
AAH21931.1Gene Name
CEBPB
Gene Alias
C/EBP-beta, CRP2, IL6DBP, LAP, MGC32080, NF-IL6, TCF5
Gene Description
CCAAT/enhancer binding protein (C/EBP), beta
Omim ID
189965Gene Ontology
HyperlinkGene Summary
The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related proteins CEBP-alpha, CEBP-delta, and CEBP-gamma. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses and has been shown to bind to the IL-1 response element in the IL-6 gene, as well as to regulatory regions of several acute-phase and cytokine genes. In addition, the encoded protein can bind the promoter and upstream element and stimulate the expression of the collagen type I gene. [provided by RefSeq
Other Designations
CCAAT/enhancer binding protein beta|interleukin 6-dependent DNA-binding protein|liver-enriched transcriptional activator protein|nuclear factor of interleukin 6|transcription factor 5
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com