Product Browser

Last updated: 2014/7/21
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Application

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDX1 monoclonal antibody (M04), clone 3C5

  • Catalog # : H00001044-M04
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant CDX1.
  • Immunogen:
  • CDX1 (NP_001795, 126 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1044
  • Gene Name:
  • CDX1
  • Gene Alias:
  • MGC116915
  • Gene Description:
  • caudal type homeobox 1
  • Gene Summary:
  • This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity. [provided by RefSeq
  • Other Designations:
  • caudal type homeo box transcription factor 1,caudal type homeobox transcription factor 1,caudal-type homeobox protein CDX1
  • RSS
  • YouTube
  • Linkedin
  • Facebook