CDKN2B monoclonal antibody (M07), clone 8C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant CDKN2B.
Immunogen
CDKN2B (AAH14469, 1 a.a. ~ 138 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MREENKGIPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (40.92 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CDKN2B expression in transfected 293T cell line by CDKN2B monoclonal antibody (M07), clone 8C4.
Lane 1: CDKN2B transfected lysate(14.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDKN2B is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — CDKN2B
Entrez GeneID
1030GeneBank Accession#
BC014469Protein Accession#
AAH14469Gene Name
CDKN2B
Gene Alias
CDK4I, INK4B, MTS2, P15, TP15, p15INK4b
Gene Description
cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
Omim ID
600431Gene Ontology
HyperlinkGene Summary
This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq
Other Designations
CDK inhibitory protein|CDK4B inhibitor|OTTHUMP00000021154|OTTHUMP00000021155|cyclin-dependent kinase 4 inhibitor B|cyclin-dependent kinase inhibitor 2B|cyclin-dependent kinases 4 and 6 binding protein|multiple tumor suppressor 2|p14_CDK inhibitor|p14_INK4
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com