CDK4 monoclonal antibody (M07), clone 8C3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDK4.
Immunogen
CDK4 (AAH03644, 211 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.97 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CDK4 monoclonal antibody (M07), clone 8C3 Western Blot analysis of CDK4 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
CDK4 monoclonal antibody (M07), clone 8C3. Western Blot analysis of CDK4 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
CDK4 monoclonal antibody (M07), clone 8C3. Western Blot analysis of CDK4 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDK4 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — CDK4
Entrez GeneID
1019GeneBank Accession#
BC003644Protein Accession#
AAH03644Gene Name
CDK4
Gene Alias
CMM3, MGC14458, PSK-J3
Gene Description
cyclin-dependent kinase 4
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported. [provided by RefSeq
Other Designations
cell division kinase 4|melanoma cutaneous malignant, 3
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com