CDC2 monoclonal antibody (M03), clone 1G10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CDC2 monoclonal antibody (M03), clone 1G10. Western Blot analysis of CDC2 expression in NIH/3T3(Cat # L018V1 ).
Western Blot (Cell lysate)
CDC2 monoclonal antibody (M03), clone 1G10. Western Blot analysis of CDC2 expression in Raw 264.7(Cat # L024V1 ).
Western Blot (Cell lysate)
CDC2 monoclonal antibody (M03), clone 1G10. Western Blot analysis of CDC2 expression in PC-12(Cat # L012V1 ).
Western Blot (Cell lysate)
CDC2 monoclonal antibody (M03), clone 1G10 Western Blot analysis of CDC2 expression in Hela S3 NE ( Cat # L013V3 ).
Immunofluorescence
Immunofluorescence of monoclonal antibody to CDC2 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.31 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDC2.
Immunogen
CDC2 (AAH14563, 211 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG1
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.31 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CDC2 monoclonal antibody (M03), clone 1G10. Western Blot analysis of CDC2 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
CDC2 monoclonal antibody (M03), clone 1G10. Western Blot analysis of CDC2 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
CDC2 monoclonal antibody (M03), clone 1G10. Western Blot analysis of CDC2 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
CDC2 monoclonal antibody (M03), clone 1G10 Western Blot analysis of CDC2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CDC2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — CDC2
Entrez GeneID
983GeneBank Accession#
BC014563Protein Accession#
AAH14563Gene Name
CDC2
Gene Alias
CDC28A, CDK1, DKFZp686L20222, MGC111195
Gene Description
cell division cycle 2, G1 to S and G2 to M
Omim ID
116940Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000019660|cell cycle controller CDC2|cell division control protein 2 homolog|cell division cycle 2 protein|cyclin-dependent kinase 1|p34 protein kinase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com