Product Browser

Last updated: 2014/11/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD79A purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00000973-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human CD79A protein.
  • Immunogen:
  • CD79A (NP_001774.1, 1 a.a. ~ 226 a.a) full-length human protein.
  • Sequence:
  • MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CD79A expression in transfected 293T cell line (H00000973-T02) by CD79A MaxPab polyclonal antibody.

    Lane 1: CD79A transfected lysate(25.00 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 973
  • Gene Name:
  • CD79A
  • Gene Alias:
  • IGA,MB-1
  • Gene Description:
  • CD79a molecule, immunoglobulin-associated alpha
  • Gene Summary:
  • The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
  • Other Designations:
  • B-cell antigen receptor complex-associated protein alpha chain,CD79A antigen,CD79a antigen (immunoglobulin-associated alpha),MB-1 membrane glycoprotein,surface IgM-associated protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook