Product Browser

Last updated: 2014/10/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SCARB2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000950-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SCARB2 partial ORF ( NP_005497, 339 a.a. - 437 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • FPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTLIITN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000950-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 950
  • Gene Name:
  • SCARB2
  • Gene Alias:
  • AMRF,CD36L2,HLGP85,LIMPII,SR-BII
  • Gene Description:
  • scavenger receptor class B, member 2
  • Gene Summary:
  • The protein encoded by this gene is a type III glycoprotein that is located primarily in limiting membranes of lysosomes and endosomes. Studies of the similar protein in mice and rat suggested that this protein may participate in membrane transportation and the reorganization of endosomal/lysosomal compartment. Deficiency of the similar protein in mice was reported to impair cell membrane transport processes and cause pelvic junction obstruction, deafness, and peripheral neuropathy. [provided by RefSeq
  • Other Designations:
  • 85 kDa lysosomal sialoglycoprotein scavenger receptor class B, member 2,CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 2 (lysosomal integral membrane protein II),lysosomal integral membrane protein II
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook