Product Browser

Last updated: 2014/9/15
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD7 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00000924-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human CD7 protein.
  • Immunogen:
  • CD7 (NP_006128.1, 1 a.a. ~ 240 a.a) full-length human protein.
  • Sequence:
  • MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CD7 expression in transfected 293T cell line (H00000924-T02) by CD7 MaxPab polyclonal antibody.

    Lane 1: CD7 transfected lysate(25.40 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 924
  • Gene Name:
  • CD7
  • Gene Alias:
  • GP40,LEU-9,TP41,Tp40
  • Gene Description:
  • CD7 molecule
  • Gene Summary:
  • This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. [provided by RefSeq
  • Other Designations:
  • CD7 antigen,CD7 antigen (p41),T-cell antigen CD7,T-cell leukemia antigen,p41 protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook