CD3E (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CD3E full-length ORF ( AAH49847.1, 23 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
46.09
Interspecies Antigen Sequence
Mouse (65); Rat (61)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CD3E
Entrez GeneID
916GeneBank Accession#
BC049847Protein Accession#
AAH49847.1Gene Name
CD3E
Gene Alias
FLJ18683, T3E, TCRE
Gene Description
CD3e molecule, epsilon (CD3-TCR complex)
Omim ID
186830Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. [provided by RefSeq
Other Designations
CD3-epsilon|CD3E antigen, epsilon polypeptide|CD3e antigen, epsilon polypeptide (TiT3 complex)|T-cell antigen receptor complex, epsilon subunit of T3|T-cell surface antigen T3/Leu-4 epsilon chain|T-cell surface glycoprotein CD3 epsilon chain
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com