Product Browser

Last updated: 2014/7/28

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CAMK2A (Human) Recombinant Protein (Q01)

  • Catalog # : H00000815-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CAMK2A partial ORF ( AAH40457, 305 a.a. - 410 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.29
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000815-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 815
  • Gene Name:
  • CAMK2A
  • Gene Alias:
  • CAMKA,KIAA0968
  • Gene Description:
  • calcium/calmodulin-dependent protein kinase II alpha
  • Gene Summary:
  • The product of this gene belongs to the serine/threonine protein kinases family, and to the Ca(2+)/calmodulin-dependent protein kinases subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. This calcium calmodulin-dependent protein kinase is composed of four different chains: alpha, beta, gamma, and delta. The alpha chain encoded by this gene is required for hippocampal long-term potentiation (LTP) and spatial learning. In addition to its calcium-calmodulin (CaM)-dependent activity, this protein can undergo autophosphorylation, resulting in CaM-independent activity. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • CaM kinase II alpha subunit,CaM-kinase II alpha chain,CaMK-II alpha subunit,CaMKIINalpha,OTTHUMP00000165787,OTTHUMP00000165788,calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha,calcium/calmodulin-dependent protein kinase II alpha-B subunit
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook