CAMK2A monoclonal antibody (M01), clone 2C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CAMK2A monoclonal antibody (M01), clone 2C4. Western Blot analysis of CAMK2A expression in human stomach.
Western Blot (Cell lysate)
CAMK2A monoclonal antibody (M01), clone 2C4. Western Blot analysis of CAMK2A expression in RIN-m5F.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CAMK2A is approximately 3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to CAMK2A on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.29 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CAMK2A.
Immunogen
CAMK2A (AAH40457, 305 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPV
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.29 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CAMK2A monoclonal antibody (M01), clone 2C4. Western Blot analysis of CAMK2A expression in human stomach.Western Blot (Cell lysate)
CAMK2A monoclonal antibody (M01), clone 2C4. Western Blot analysis of CAMK2A expression in RIN-m5F.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CAMK2A is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CAMK2A on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CAMK2A
Entrez GeneID
815GeneBank Accession#
BC040457Protein Accession#
AAH40457Gene Name
CAMK2A
Gene Alias
CAMKA, KIAA0968
Gene Description
calcium/calmodulin-dependent protein kinase II alpha
Omim ID
114078Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the serine/threonine protein kinases family, and to the Ca(2+)/calmodulin-dependent protein kinases subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. This calcium calmodulin-dependent protein kinase is composed of four different chains: alpha, beta, gamma, and delta. The alpha chain encoded by this gene is required for hippocampal long-term potentiation (LTP) and spatial learning. In addition to its calcium-calmodulin (CaM)-dependent activity, this protein can undergo autophosphorylation, resulting in CaM-independent activity. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
CaM kinase II alpha subunit|CaM-kinase II alpha chain|CaMK-II alpha subunit|CaMKIINalpha|OTTHUMP00000165787|OTTHUMP00000165788|calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha|calcium/calmodulin-dependent protein kinase II alpha-B subunit
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com