C4BPA purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human C4BPA protein.
Immunogen
C4BPA (NP_000706.1, 1 a.a. ~ 597 a.a) full-length human protein.
Sequence
MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLLGHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIHCDADSKWNPSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTPSCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Rat (59)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
C4BPA MaxPab rabbit polyclonal antibody. Western Blot analysis of C4BPA expression in mouse kidney.Western Blot (Transfected lysate)
Western Blot analysis of C4BPA expression in transfected 293T cell line (H00000722-T02) by C4BPA MaxPab polyclonal antibody.
Lane 1: C4BPA transfected lysate(67.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — C4BPA
Entrez GeneID
722GeneBank Accession#
NM_000715.3Protein Accession#
NP_000706.1Gene Name
C4BPA
Gene Alias
C4BP, PRP
Gene Description
complement component 4 binding protein, alpha
Omim ID
120830Gene Ontology
HyperlinkGene Summary
This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Two pseudogenes of this gene are also found in the cluster. [provided by RefSeq
Other Designations
C4b binding protein, alpha chain|OTTHUMP00000034376|complement component 4 binding protein, alpha chain|complement component 4-binding protein, alpha|proline-rich protein
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Organism-wide, cell-type-specific secretome mapping of exercise training in mice.
Wei Wei, Nicholas M Riley, Xuchao Lyu, Xiaotao Shen, Jing Guo, Steffen H Raun, Meng Zhao, Maria Dolores Moya-Garzon, Himanish Basu, Alan Sheng-Hwa Tung, Veronica L Li, Wentao Huang, Amanda L Wiggenhorn, Katrin J Svensson, Michael P Snyder, Carolyn R Bertozzi, Jonathan Z Long.
Cell Metabolism 2023 Apr; S1550-4131(23):138.
Application:WB, Mouse, Mouse plasma.
-
Organism-wide, cell-type-specific secretome mapping of exercise training in mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com