C1QB purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human C1QB protein.
Immunogen
C1QB (NP_000482.3, 1 a.a. ~ 253 a.a) full-length human protein.
Sequence
MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (79)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
C1QB MaxPab rabbit polyclonal antibody. Western Blot analysis of C1QB expression in human pancreas.Western Blot (Tissue lysate)
C1QB MaxPab rabbit polyclonal antibody. Western Blot analysis of C1QB expression in human kidney.Western Blot (Tissue lysate)
C1QB MaxPab rabbit polyclonal antibody. Western Blot analysis of C1QB expression in mouse stomach.Western Blot (Cell lysate)
C1QB MaxPab rabbit polyclonal antibody. Western Blot analysis of C1QB expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of C1QB expression in transfected 293T cell line (H00000713-T03) by C1QB MaxPab polyclonal antibody.
Lane 1: C1QB transfected lysate(26.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — C1QB
Entrez GeneID
713GeneBank Accession#
NM_000491Protein Accession#
NP_000482.3Gene Name
C1QB
Gene Alias
-
Gene Description
complement component 1, q subcomponent, B chain
Omim ID
120570Gene Ontology
HyperlinkGene Summary
This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the B-chain polypeptide of human complement subcomponent C1q [provided by RefSeq
Other Designations
OTTHUMP00000002940|complement component 1, q subcomponent, beta polypeptide|complement component C1q, B chain|complement subcomponent C1q chain B
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com