Product Browser

Last updated: 2014/7/21
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRDM1 monoclonal antibody (M04), clone 2F8

  • Catalog # : H00000639-M04
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant PRDM1.
  • Immunogen:
  • PRDM1 (NP_001189, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000639-M04
    Western Blot detection against Immunogen (37.73 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • PRDM1 monoclonal antibody (M04), clone 2F8. Western Blot analysis of PRDM1 expression in human skeletal muscle.
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PRDM1 monoclonal antibody (M04), clone 2F8 Western Blot analysis of PRDM1 expression in SJCRH30 ( Cat # L027V1 ).
  • Protocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged PRDM1 is approximately 3ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 639
  • Gene Name:
  • PRDM1
  • Gene Alias:
  • BLIMP1,MGC118922,MGC118923,MGC118924,MGC118925,PRDI-BF1
  • Gene Description:
  • PR domain containing 1, with ZNF domain
  • Gene Summary:
  • This gene encodes a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • B-lymphocyte-induced maturation protein 1,OTTHUMP00000016918,PR-domain zinc finger protein 1,PRDI-binding factor-1,beta-interferon gene positive-regulatory domain I binding factor,positive regulatory domain I-binding factor 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook