Product Browser
 
  • Related Product Showcase
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

PRDM1 monoclonal antibody (M01), clone 2B10   

  • Catalog # : H00000639-M01
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 100 ug
  • USD $ 319
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant PRDM1.
  • Immunogen:
  • PRDM1 (NP_001189, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000639-M01
    Western Blot detection against Immunogen (37.73 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • PRDM1 monoclonal antibody (M01), clone 2B10. Western Blot analysis of PRDM1 expression in human spleen.
  • Protocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • PRDM1 monoclonal antibody (M01), clone 2B10. Western Blot analysis of PRDM1 expression in human tongue.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PRDM1 expression in transfected 293T cell line by PRDM1 monoclonal antibody (M01), clone 2B10.

    Lane 1: PRDM1 transfected lysate(88 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged PRDM1 is approximately 0.3ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of PRDM1 over-expressed 293 cell line, cotransfected with PRDM1 Validated Chimera RNAi ( Cat # H00000639-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PRDM1 monoclonal antibody (M01), clone 2B10 (Cat # H00000639-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • Protocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 639
  • Gene Name:
  • PRDM1
  • Gene Alias:
  • BLIMP1,MGC118922,MGC118923,MGC118924,MGC118925,PRDI-BF1
  • Gene Description:
  • PR domain containing 1, with ZNF domain
  • Gene Summary:
  • This gene encodes a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • B-lymphocyte-induced maturation protein 1,OTTHUMP00000016918,PR-domain zinc finger protein 1,PRDI-binding factor-1,beta-interferon gene positive-regulatory domain I binding factor,positive regulatory domain I-binding factor 1
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!