Product Browser

Last updated: 2014/9/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BCL2 polyclonal antibody (A01)

  • Catalog # : H00000596-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant BCL2.
  • Immunogen:
  • BCL2 (AAH27258, 140 a.a. ~ 239 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 596
  • Gene Name:
  • BCL2
  • Gene Alias:
  • Bcl-2
  • Gene Description:
  • B-cell CLL/lymphoma 2
  • Gene Summary:
  • This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Two transcript variants, produced by alternate splicing, differ in their C-terminal ends. [provided by RefSeq
  • Other Designations:
  • B-cell lymphoma protein 2,OTTHUMP00000163680
  • RSS
  • YouTube
  • Linkedin
  • Facebook