AXL monoclonal antibody (M01), clone 6C8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant AXL.
Immunogen
AXL (AAH32229, 30 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPY
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
AXL monoclonal antibody (M01), clone 6C8 Western Blot analysis of AXL expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of AXL expression in transfected 293T cell line by AXL monoclonal antibody (M01), clone 6C8.
Lane 1: AXL transfected lysate(98 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AXL is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of AXL over-expressed 293 cell line, cotransfected with AXL Validated Chimera RNAi ( Cat # H00000558-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with AXL monoclonal antibody (M01) clone 6C8 (Cat # H00000558-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — AXL
Entrez GeneID
558GeneBank Accession#
BC032229Protein Accession#
AAH32229Gene Name
AXL
Gene Alias
JTK11, UFO
Gene Description
AXL receptor tyrosine kinase
Omim ID
109135Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the receptor tyrosine kinase subfamily. Although it is similar to other receptor tyrosine kinases, this protein represents a unique structure of the extracellular region that juxtaposes IgL and FNIII repeats. It transduces signals from the extracellular matrix into the cytoplasm by binding growth factors like vitamin K-dependent protein growth-arrest-specific gene 6. It is involved in the stimulation of cell proliferation and can also mediate cell aggregation by homophilic binding. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
AXL transforming sequence/gene|oncogene AXL
-
Interactomes
-
Diseases
-
Publication Reference
-
Axl/Gas6/NFkB signalling in schwannoma pathological proliferation, adhesion and survival.
Ammoun S, Provenzano L, Zhou L, Barczyk M, Evans K, Hilton DA, Hafizi S, Hanemann CO.
Oncogene 2013 Jan; 33(3):336.
Application:IHC, Human, Schwannoma tissues.
-
Gain-of-Function Activity of Mutant p53 in Lung Cancer through Up-Regulation of Receptor Protein Tyrosine Kinase Axl.
Vaughan CA, Singh S, Windle B, Yeudall WA, Frum R, Grossman SR, Deb SP, Deb S.
Genes & Cancer 2012 Jul; 3(7-8):491.
Application:WB-Tr, Human, H1048, H1299, H1793 cells.
-
Axl/Gas6/NFkB signalling in schwannoma pathological proliferation, adhesion and survival.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com