Product Browser

Last updated: 2014/7/21
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ATR monoclonal antibody (M03), clone 1E9

  • Catalog # : H00000545-M03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant ATR.
  • Immunogen:
  • ATR (NP_001175, 2545 a.a. ~ 2644 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • DQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to ATR on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
  • Protocol Download
  • ELISA
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 545
  • Gene Name:
  • ATR
  • Gene Alias:
  • FRP1,MEC1,SCKL,SCKL1
  • Gene Description:
  • ataxia telangiectasia and Rad3 related
  • Other Designations:
  • FRAP-related protein-1,MEC1, mitosis entry checkpoint 1, homolog,Rad3 related protein,ataxia telangiectasia and Rad3 related protein,protein kinase ATR
  • RSS
  • YouTube
  • Linkedin
  • Facebook