ATP6V1E1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ATP6V1E1 protein.
Immunogen
ATP6V1E1 (NP_001687.1, 1 a.a. ~ 226 a.a) full-length human protein.
Sequence
MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ATP6V1E1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ATP6V1E1 expression in human kidney.Western Blot (Tissue lysate)
ATP6V1E1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ATP6V1E1 expression in mouse lung.Western Blot (Cell lysate)
ATP6V1E1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ATP6V1E1 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of ATP6V1E1 expression in transfected 293T cell line (H00000529-T04) by ATP6V1E1 MaxPab polyclonal antibody.
Lane 1: ATP6V1E1 transfected lysate(26.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ATP6V1E1
Entrez GeneID
529GeneBank Accession#
NM_001696.3Protein Accession#
NP_001687.1Gene Name
ATP6V1E1
Gene Alias
ATP6E, ATP6E2, ATP6V1E, P31, Vma4
Gene Description
ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1
Omim ID
108746Gene Ontology
HyperlinkGene Summary
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain E subunit isoforms. Pseudogenes for this gene have been found in the genome. [provided by RefSeq
Other Designations
ATPase, H+ transporting, lysosomal (vacuolar proton pump) 31kD|H(+)-transporting two-sector ATPase, 31kDa subunit|H+-transporting ATP synthase chain E, vacuolar|V-ATPase, subunit E|vacuolar H+ ATPase E1
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com