ATP4B purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Rabbit polyclonal antibody raised against a full-length human ATP4B protein.
Immunogen
ATP4B (AAH29059, 1 a.a. ~ 291 a.a) full-length human protein.
Sequence
MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ATP4B MaxPab rabbit polyclonal antibody. Western Blot analysis of ATP4B expression in mouse liver.Western Blot (Tissue lysate)
ATP4B MaxPab rabbit polyclonal antibody. Western Blot analysis of ATP4B expression in human pancreas.Western Blot (Transfected lysate)
Western Blot analysis of ATP4B expression in transfected 293T cell line (H00000496-T03) by ATP4B MaxPab polyclonal antibody.
Lane 1: ATP4B transfected lysate(32.12 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ATP4B
Entrez GeneID
496GeneBank Accession#
BC029059Protein Accession#
AAH29059Gene Name
ATP4B
Gene Alias
ATP6B
Gene Description
ATPase, H+/K+ exchanging, beta polypeptide
Omim ID
137217Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. [provided by RefSeq
Other Designations
ATPase, H+/K+ transporting, beta polypeptide|gastric H+/K+ ATPase beta subunit|gastric hydrogen-potassium ATPase, beta|hydrogen/potassium-exchanging ATPase 4B|potassium-transporting ATPase beta chain|proton pump beta chain
-
Interactomes
-
Pathways
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com