ATP1B3 monoclonal antibody (M03), clone 1E9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ATP1B3.
Immunogen
ATP1B3 (AAH11835, 1 a.a. ~ 279 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ATP1B3 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — ATP1B3
Entrez GeneID
483GeneBank Accession#
BC011835Protein Accession#
AAH11835Gene Name
ATP1B3
Gene Alias
ATPB-3, CD298, FLJ29027
Gene Description
ATPase, Na+/K+ transporting, beta 3 polypeptide
Omim ID
601867Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 3 subunit. This gene encodes a beta 3 subunit. A pseudogene exists for this gene, and it is located on chromosome 2. [provided by RefSeq
Other Designations
Na+/K+ -ATPase beta 3 subunit|Na, K-ATPase beta-3 polypeptide|sodium/potassium-dependent ATPase beta-3 subunit|sodium/potassium-transporting ATPase beta-3 chain
-
Interactome
-
Pathway
-
Publication Reference
-
The importance of adequate fixation for immunofluorescent staining of bovine embryos.
Goossens K, Vandaele L, Wydooghe E, Thys M, Dewulf J, Peelman Lj, Van Soom A.
Reprod Domest Anim 2011 Mar; 46:1098.
Application:IF, Bovine, Blastocysts.
-
The importance of adequate fixation for immunofluorescent staining of bovine embryos.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com