Product Browser

Last updated: 2014/12/14
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ASCL1 polyclonal antibody (A01)

  • Catalog # : H00000429-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ASCL1.
  • Immunogen:
  • ASCL1 (NP_004307, 137 a.a. ~ 236 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000429-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ASCL1 expression in transfected 293T cell line by ASCL1 polyclonal antibody (A01).

    Lane1:ASCL1 transfected lysate (Predicted MW: 25.5 KDa).
    Lane2:Non-transfected lysate.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 429
  • Gene Name:
  • ASCL1
  • Gene Alias:
  • ASH1,HASH1,MASH1,bHLHa46
  • Gene Description:
  • achaete-scute complex homolog 1 (Drosophila)
  • Gene Summary:
  • This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. [provided by RefSeq
  • Other Designations:
  • achaete scute protein,achaete-scute complex homolog 1,achaete-scute complex-like 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook