Product Browser

Last updated: 2014/10/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ASAH1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000427-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ASAH1 partial ORF ( NP_808592, 25 a.a. - 124 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPMLKVIVNSLKNMINTFVPSGKVMQVVDEKLPGLLGNFPGPFEEEMKGIAAVTD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000427-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 427
  • Gene Name:
  • ASAH1
  • Gene Alias:
  • AC,ASAH,FLJ21558,FLJ22079,PHP,PHP32
  • Gene Description:
  • N-acylsphingosine amidohydrolase (acid ceramidase) 1
  • Gene Summary:
  • This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into sphingosine and fatty acid. Mutations in this gene have been associated with a lysosomal storage disorder known as Farber disease. Multiple transcript variants encoding several distinct isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • N-acylsphingosine amidohydrolase 1,OTTHUMP00000122482,acylsphingosine deacylase,putative 32 kDa heart protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook